Skip to content

Peptide Comparison Tool

Compare multiple peptides side-by-side across key parameters — class, sequence length, molecular weight, mechanism, and research applications. Request COA and product specification sheets for compared peptides.

Compare Peptides

Select 2–4 peptides to compare. Data is sourced from verified reference databases.

How to Use This Comparison for Research Decisions

When selecting a peptide for research, the comparison matrix above provides a structured way to evaluate candidates across multiple dimensions. Here's how to use it effectively:

1. Compare by Core Parameters

Start by reviewing class, sequence length, molecular weight, and mechanism of action for each peptide. These parameters define the fundamental characteristics of each compound and determine its suitability for specific research applications.

  • Class tells you the peptide's functional category (e.g., GLP-1 agonist, tissue repair, neuropeptide) — peptides within the same class often share overlapping mechanisms
  • Length and MW affect stability, solubility, and administration considerations in research protocols
  • Mechanism of action is the most critical differentiator — two peptides targeting the same general area may work through entirely different pathways

2. Understand Key Category Differences

GLP-1 Agonists — Tirzepatide vs. Semaglutide vs. Retatrutide

These three metabolic peptides illustrate how subtle receptor-targeting differences can lead to distinct research applications:

Peptide Receptor Target Research Application
Tirzepatide GIP + GLP-1 (dual agonist) Dual pathway metabolic research, comparative efficacy studies
Semaglutide GLP-1 (selective agonist) Selective GLP-1 receptor studies, monotherapy models
Retatrutide GIP + GLP-1 + Glucagon (triple agonist) Triple agonism research, multi-receptor crosstalk studies

Tirzepatide's dual agonism activates both GIP and GLP-1 receptors, offering broader metabolic pathway research. Semaglutide's selective GLP-1 agonism provides a focused tool for studying GLP-1-specific effects. Retatrutide's triple agonism adds glucagon receptor activation, enabling research into combined energy expenditure and glycemic control pathways.

Tissue Repair — BPC-157 vs. TB-500

These two popular regenerative peptides work through fundamentally different mechanisms:

  • BPC-157 promotes angiogenesis (formation of new blood vessels) and systemic tissue protection, supporting recovery through improved blood supply to damaged tissues
  • TB-500 (Thymosin β4 fragment) binds actin and promotes cell migration, supporting tissue regeneration through cytoskeletal remodeling and cell motility

Using these peptides in combination for research can explore synergistic mechanisms — angiogenesis from BPC-157 paired with actin-binding cell migration from TB-500 addresses tissue repair through complementary pathways.

3. Apply Comparisons to Purchasing Decisions

The comparison matrix directly links to product pages and COA requests. After evaluating peptides side-by-side:

  • Use the product links in the comparison table to navigate directly to detailed specification sheets
  • Click Request COA to obtain Certificate of Analysis documentation for the peptides you've compared
  • Cross-reference molecular weight, sequence, and purity data against your research protocol requirements

Peptide Selection Guide

Use this quick-reference table to identify the best peptide for your specific research objective:

Research Goal Recommended Peptide(s) Reason
Metabolic / Weight Loss Research Tirzepatide or Semaglutide GLP-1 receptor agonism for metabolic pathway studies
Triple Agonism Research Retatrutide GIP + GLP-1 + glucagon triple receptor activation
Soft Tissue Recovery Research BPC-157 + TB-500 Synergistic angiogenesis + actin-binding mechanisms
Dermal / Anti-Aging Research GHK-Cu Copper-dependent collagen synthesis and matrikine signaling
Cognitive Enhancement Research Semax BDNF and NGF modulation for neuroprotection studies
Sleep / Pineal Function Research Epitalon Telomerase regulation and circadian rhythm modulation
GH Secretagogue Research MK-677 or Ipamorelin GHS receptor agonism for growth hormone pathway studies

This guide maps research goals to specific peptides, but always verify detailed specifications — including purity, sequence confirmation, and stability data — via the product pages and COA documentation.

Frequently Asked Questions

How do I know which peptide is right for my research?

Start by identifying your research goal (e.g., metabolic studies, tissue repair, cognitive function). Use the Peptide Selection Guide above to match your goal to a recommended peptide. Then use the comparison tool to evaluate 2–4 candidates side-by-side by class, mechanism, molecular weight, and research applications. Finally, review the detailed technical profiles at data.rplpeptides.com and request a Certificate of Analysis to verify purity and specifications.

What's the difference between GLP-1 agonists?

GLP-1 agonists differ primarily in their receptor selectivity profile. Semaglutide is a selective GLP-1 receptor agonist, targeting only the GLP-1 pathway. Tirzepatide is a dual agonist (GIP + GLP-1), activating two receptor systems simultaneously. Retatrutide is a triple agonist (GIP + GLP-1 + glucagon), adding glucagon receptor activation for broader metabolic research. The choice depends on whether your research requires single-pathway selectivity, dual-pathway comparison, or multi-receptor crosstalk analysis.

Can I compare peptides from different categories?

Yes — the comparison tool is designed to work across categories. You can select peptides from any combination of classes (e.g., a GLP-1 agonist alongside a tissue repair peptide). The matrix will display all key parameters side-by-side, allowing you to evaluate class, mechanism, and structural differences even across unrelated peptide families. This is useful for broad surveying or when designing multi-compound research protocols.

How do I request a Certificate of Analysis?

After selecting the peptides you'd like to compare, click the "Request COA →" button displayed in the comparison results. This will take you to the COA request form at rplpeptides.com/coa-request/ with the first compared peptide pre-selected. You can request COAs for any or all of the compared peptides from the form. Certificates include verified purity, sequence confirmation, and analytical data.

Where can I find more detailed technical data?

Visit data.rplpeptides.com for comprehensive technical profiles on each peptide, including detailed sequence information, structural data, stability studies, and research references. Product-specific specification sheets are also available from each product page at rplpeptides.com.

From Comparison to Purchase

The comparison matrix is more than a research tool — it's your bridge from product specifications to purchasing decisions.

How to Take the Next Steps

  1. Compare your candidates using the interactive tool above to evaluate class, mechanism, molecular weight, and applications side-by-side
  2. Visit data.rplpeptides.com for full technical profiles — each peptide's detailed characterization including sequence confirmation, analytical data, and research references
  3. Request a Certificate of Analysis from rplpeptides.com/coa-request/ to verify purity and specifications before purchase
  4. Browse and order from the complete product catalog — each product page links back to the corresponding comparison data

Why This Matters

The comparison tool links product specifications directly to research needs. Instead of jumping between datasheets, you can evaluate multiple candidates in a single view, match parameters to your protocol requirements, and proceed directly to documentation or purchase — all from one interface.

Browse All Products at rplpeptides.com →

Peptide Reference Data

Peptide Class Length MW (Da) Sequence (1-letter)
Tirzepatide GIP/GLP-1 Dual Agonist 39 4,813.5 YXGEGTFTSDYSILDSKKQRAKQFVQWLLAGGPSSGAPPPS
Semaglutide GLP-1 Agonist 31 4,113.6 HGEGTFTSDVSSYLEEQAAKEFIAWLVKGRG
Retatrutide Triple GIP/GLP-1/GCG 39 4,840.6 YXGEGTFTSDYSILDSKKQRAKQFVQWLLAGGPSSGAPPPS
BPC-157 Tissue Repair 15 1,419.5 GEPPPGKPADDAGLV
TB-500 Regenerative 5 500.5 Ac-SDKP
GHK-Cu Cosmetic 3 466.4 (complex) GHK
Semax Neuropeptide 7 706.8 MEHFPGP
Epitalon Pineal Regulator 4 375.4 AEDG
MK-677 GHS Agonist N/A (small mol.) 528.7 N/A

Using Comparison Results

The comparison tool helps you:

  1. Evaluate alternatives — Compare structural and functional differences between peptide candidates
  2. Inform purchasing decisions — Side-by-side parameter comparison for procurement
  3. Cross-reference with data.rplpeptides.com — Detailed technical profiles for each compound
  4. Request documentation — Direct CTA to COA requests and product specifications